PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.78PTT
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 366aa    MW: 40456 Da    PI: 7.6734
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.78PTTgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.68.1e-56191471129
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                  lppGfrFhPtdeel+++yL kkv +++++  ++i+evd++k+ePw+Lp+k+k +ekewyfFs rd+ky+tg r+nrat++gyWkatgkd+e++s+ + 
  Araip.78PTT  19 LPPGFRFHPTDEELITYYLVKKVLDNTFTG-RAIAEVDLNKCEPWELPEKAKMGEKEWYFFSLRDRKYPTGLRTNRATEAGYWKATGKDREIYSSkTC 115
                  79*************************999.89***************99999****************************************97455 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrle 129
                  +lvg+kktLvfy+grapkgek++Wvmheyrle
  Araip.78PTT 116 ALVGMKKTLVFYRGRAPKGEKSNWVMHEYRLE 147
                  67****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-6210171IPR003441NAC domain
PROSITE profilePS5100559.99919171IPR003441NAC domain
PfamPF023651.4E-2820146IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010072Biological Processprimary shoot apical meristem specification
GO:0010160Biological Processformation of organ boundary
GO:0010223Biological Processsecondary shoot formation
GO:0048366Biological Processleaf development
GO:0048504Biological Processregulation of timing of organ formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MDSFYHHHNH HFDNSDTHLP PGFRFHPTDE ELITYYLVKK VLDNTFTGRA IAEVDLNKCE  60
PWELPEKAKM GEKEWYFFSL RDRKYPTGLR TNRATEAGYW KATGKDREIY SSKTCALVGM  120
KKTLVFYRGR APKGEKSNWV MHEYRLEGKF AYHYLSRSSK DEWVISRVFQ KTTTGGGGGG  180
GGSAVSTTAG GSKKAKMSTS TTTSTMSFCP EPSSPSSVYL PPLLDSSPYT TATTGSVTSA  240
AAAYDGRQSS SFDNNNNDST REHVSCFSTI SNNFVNGFFD LAPMDSFARF QRNNNVGVSA  300
FPSLRSQQDN LQINPLFFSA AAAQPLHGGE LHAAGAWPVP EDQRVAEAAA AGMALGHSEL  360
DCMWGY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-521917417168NO APICAL MERISTEM PROTEIN
1ut4_B6e-521917417168NO APICAL MERISTEM PROTEIN
1ut7_A6e-521917417168NO APICAL MERISTEM PROTEIN
1ut7_B6e-521917417168NO APICAL MERISTEM PROTEIN
4dul_A6e-521917417168NAC domain-containing protein 19
4dul_B6e-521917417168NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00562DAPTransfer from AT5G53950Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016169357.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 2-like
SwissprotO040171e-119NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
TrEMBLA0A0S3SIB51e-176A0A0S3SIB5_PHAAN; Uncharacterized protein
TrEMBLA0A0L9ULI41e-176A0A0L9ULI4_PHAAN; Uncharacterized protein
STRINGGLYMA12G26190.11e-172(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36893463
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53950.11e-107NAC family protein